PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004498559.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Trihelix
Protein Properties Length: 314aa    MW: 36344.6 Da    PI: 5.085
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004498559.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix25.43.7e-082290270
        trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70
                    Wt  e l L++ +  +e + + + +  ++We ++ ++++  + r+  qC+ kw +l  +y   ++++++
  XP_004498559.1 22 WTVTESLILVNEVAAVEAECSVNLSSYQRWEIIAGNCAALDVDRNLAQCRRKWCSLLSEYDDFRRRRSS 90
                    ************************************************************998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138371.7E-621100No hitNo description
PROSITE profilePS500906.5512278IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MTENARDTVG NRRTRSQAAP DWTVTESLIL VNEVAAVEAE CSVNLSSYQR WEIIAGNCAA  60
LDVDRNLAQC RRKWCSLLSE YDDFRRRRSS SNLDLELFTA VERVVKGREQ RGEVDRESDP  120
ETEKNEDVDA TVEIGPKRKK QRCKSERYCI QNPKNCWPVE SSKNLKEKQV HEDNHEEEPE  180
HNDLEDEYLK DFLEKKSKLK SPAKRRPKNI EKPHKSLAKV DENHDIEKPK PISVGNITIN  240
SEDNEEMLTL KLQELAIEIQ EITAESVDCK EANSENIVDY HTEFTRRQGD KLIARLGNFS  300
NTLKQLFDLL QECK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17087RRKWCSLLSEYDDFRRRR
2138144KKQRCKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004498559.10.0PREDICTED: uncharacterized protein LOC101507506
TrEMBLG7I5681e-160G7I568_MEDTR; Myb/SANT-like DNA-binding domain protein
STRINGGLYMA14G18790.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67322633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.16e-37sequence-specific DNA binding transcription factors